PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g088060.1
Common NameMTR_5g088060, MTR_5g488160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 462aa    MW: 51059.5 Da    PI: 8.7674
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g088060.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-16271317147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g WT++E++l++++ k++G+g+Wk I++++  ++t+ q+ s+ qky
  Medtr5g088060.1 271 KGHWTEDEHKLFLKGLKKHGKGCWKDISKEFVVTKTPTQIASHAQKY 317
                      789*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.173266322IPR017930Myb domain
SuperFamilySSF466891.65E-15270322IPR009057Homeodomain-like
SMARTSM007173.1E-11270320IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-11271316IPR009057Homeodomain-like
PfamPF002492.7E-14271317IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.3E-15272321IPR006447Myb domain, plants
CDDcd001671.45E-10274318No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MVRIRGGEQR KRVDEKSVDV PVLVVGTKSS PALSDAQTPK PINHVEKLSV PSVGQVAPRA  60
PSVQKSNGSG NFNLKNKMPS PRSRKPGPKR NRNTNGTPHF PVATMPYPNG ENPKHVSPAA  120
AGQGFTPPAH AIDAKHVQPP VQEDLNAYAV NYPNGRPNIQ EQGDHVNHGR HHQRPFPAKA  180
NMPMQHKSME GRKSIQSSLL QIDLNESASA QDPSEHSMEQ QQEKTGTNID ESGHAVAILN  240
SNDNSVETLN SNENNLIQAE SVPEESHAPR KGHWTEDEHK LFLKGLKKHG KGCWKDISKE  300
FVVTKTPTQI ASHAQKYFIH QNVKDIEKKE KKRKSIHDTT LNKNDTLVTV AVEQRDEIPS  360
VELQSVIPPQ GMQQTQTQQN EISPMLCLLP ISSTIPSVQQ QNELTPVVTA PMEQQHETPA  420
ILNNKDNENL QTQLVLLYPI GSTLPDMNKL EKMCNLLAKE L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1249720.0AC124972.41 Medicago truncatula clone mth2-24j4, complete sequence.
GenBankAC1308030.0AC130803.61 Medicago truncatula clone mth2-10g3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013454316.10.0MYB-like DNA-binding domain, shaqkyf class protein
RefseqXP_003617116.10.0MYB-like DNA-binding domain, shaqkyf class protein
TrEMBLG7K3100.0G7K310_MEDTR; MYB-like DNA-binding domain, shaqkyf class protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1691138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.15e-12MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]